PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00034.1_g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Nin-like
Protein Properties Length: 780aa    MW: 87430.6 Da    PI: 6.191
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00034.1_g00022.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK901.8e-28528578252
                   RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               k+i+l++l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Rsa1.0_00034.1_g00022.1 528 DKTITLDVLRQHFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 578
                              689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.018515598IPR003035RWP-RK domain
PfamPF020422.5E-25530578IPR003035RWP-RK domain
SuperFamilySSF542773.64E-22679774No hitNo description
SMARTSM006661.4E-26689772IPR000270PB1 domain
PROSITE profilePS5174527.566689772IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.3E-20690769No hitNo description
PfamPF005646.9E-19690771IPR000270PB1 domain
CDDcd064071.01E-40690770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 780 aa     Download sequence    Send to blast
MEDSNYLQTE NTVMDNEFMD GLLLDGCWLE TTDGSEFLNL TSSDPSSFMW PPAQDTSAIC  60
TSEVVSQTYG HHDCASLDEF QWNKRWWIGP GGGGSSVKER LVQAVEHIKD YITERGSLIQ  120
LWVPVHRGGK RVLTTREQPY SHDPLCQRLA NYREISVNYH FSAEQDDSKA LAGLPGRVFL  180
GKLPEWTPDV RFFRSEEYPR VYHAQDCDVR GTLAIPVFEQ GSKVCLGVIE VVMTTEMVKL  240
APELESICRA LQAVDLRSTE VLIQPSLKGR DLSYKAALPE IRNLLRCACE THKLPLAQTW  300
VSCLHQSKSG CRHNNENYIH CVSTIDDACY LGDPTVREFH EACSEHHLLK GQGVAGQAFL  360
TNGPCFSPDV SNYKKSEYPL SHHANMFGLH GSVAIRLRCI HTGSVDFVLE FFLPKDCDDV  420
EEQRKMLNAL STVMAHVPRS LRIVTDKELE DESEVIVTPK IEITSEHTED WLHQSSNPQN  480
LGLIFDVGDK ASDEFGLKRG FGYTKGSNVN ERSTFSSGGV ERKRTKADKT ITLDVLRQHF  540
AGSLKDAAKN IGVCPTTLKR ICRQHGIQRW PSRKIKKVGH SLQKIQRVID SVEGVSGPLP  600
IGSFYSSFPH LASSQEPSIQ GKNSLLPQPL QLSKSPVSPY SHSSSSSQCC SSETQLTATD  660
VGGGVLTLSS LENIPQSTNL SSSSQDDDFL RIKVSYGEEK IRFRMGNSRR LTDLLWEIGR  720
RFSIEDMSRC DLKYLDEDNE WVLLTCDEDV EECVSVCRTT PSHTIKLLLH VSSHCYSSWQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737919.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A0D3DQL80.0A0A0D3DQL8_BRAOL; Uncharacterized protein
STRINGBra016458.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein